PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10026205m
Common NameEUTSA_v10026205mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 218aa    MW: 25067.9 Da    PI: 7.2532
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10026205mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.22.1e-28959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien + rqvtfskRr+g+lKKA+ELSvLCda+va i+fs++g+ly+++s
  Thhalv10026205m  9 KRIENVTSRQVTFSKRRKGLLKKAHELSVLCDAQVAAIVFSQNGRLYDFAS 59
                     79***********************************************86 PP

2K-box50.77.5e-18801749100
            K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk...ekelqeenkaLrkkle 99 
                      ++++  ++l++e+a + ++ie Lq   R+l+G+dL+s+s+ eL+++  ++eksl+ +Rs+K +l  ++ie+   +   e+e+ +e  +Lr+++e
  Thhalv10026205m  80 QKQQYVQELKNEMAIMVDKIELLQLHCRKLMGQDLDSCSVDELKEITIKIEKSLTIVRSRKAKLSEDEIEKETAQiagEREVLDERSRLRQMFE 173
                      5677889*****************999******************************************9876544448899999999999887 PP

            K-box 100 e 100
                      e
  Thhalv10026205m 174 E 174
                      6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.2E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.581161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.85E-31382IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-29323IPR002100Transcription factor, MADS-box
CDDcd002651.59E-39368No hitNo description
PfamPF003191.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-293859IPR002100Transcription factor, MADS-box
PfamPF014863.7E-1782172IPR002487Transcription factor, K-box
PROSITE profilePS5129711.93385178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MVRGKIEIKR IENVTSRQVT FSKRRKGLLK KAHELSVLCD AQVAAIVFSQ NGRLYDFASS  60
DMQKMMERQY REYFGAEILQ KQQYVQELKN EMAIMVDKIE LLQLHCRKLM GQDLDSCSVD  120
ELKEITIKIE KSLTIVRSRK AKLSEDEIEK ETAQIAGERE VLDERSRLRQ MFEEKPLWMQ  180
SRNLESDKSA PSCGCGNMNV SDVETDLSIG LPESRVQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A9e-19373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B9e-19373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C9e-19373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D9e-19373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P1e-18173172Myocyte-specific enhancer factor 2B
1tqe_Q1e-18173172Myocyte-specific enhancer factor 2B
1tqe_R1e-18173172Myocyte-specific enhancer factor 2B
1tqe_S1e-18173172Myocyte-specific enhancer factor 2B
3kov_A1e-18373271Myocyte-specific enhancer factor 2A
3kov_B1e-18373271Myocyte-specific enhancer factor 2A
3kov_I1e-18373271Myocyte-specific enhancer factor 2A
3kov_J1e-18373271Myocyte-specific enhancer factor 2A
3p57_A1e-18373271Myocyte-specific enhancer factor 2A
3p57_B1e-18373271Myocyte-specific enhancer factor 2A
3p57_C1e-18373271Myocyte-specific enhancer factor 2A
3p57_D1e-18373271Myocyte-specific enhancer factor 2A
3p57_I1e-18373271Myocyte-specific enhancer factor 2A
3p57_J1e-18373271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893094e-63AC189309.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034C07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413306.11e-158hypothetical protein EUTSA_v10026205mg
SwissprotQ9FLH55e-75AGL72_ARATH; MADS-box protein AGL72
TrEMBLV4ME591e-158V4ME59_EUTSA; Uncharacterized protein
STRINGBra013891.1-P1e-100(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88051235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51860.25e-79MIKC_MADS family protein